Lineage for d1s6ua_ (1s6u A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910055Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1910056Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1910127Protein Menkes copper-transporting ATPase [55012] (1 species)
  7. 1910128Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries)
  8. 1910132Domain d1s6ua_: 1s6u A: [98608]
    2nd metal-binding domain
    complexed with cu1

Details for d1s6ua_

PDB Entry: 1s6u (more details)

PDB Description: solution structure and backbone dynamics of the cu(i) form of the second metal-binding domain of the menkes protein atp7a
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1s6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6ua_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
gevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisveemkkq
ieamgfpafvkkiegr

SCOPe Domain Coordinates for d1s6ua_:

Click to download the PDB-style file with coordinates for d1s6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1s6ua_: