Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein Menkes copper-transporting ATPase [55012] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries) |
Domain d1s6ua_: 1s6u A: [98608] 2nd metal-binding domain complexed with cu1 |
PDB Entry: 1s6u (more details)
SCOPe Domain Sequences for d1s6ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6ua_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} gevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisveemkkq ieamgfpafvkkiegr
Timeline for d1s6ua_: