SCOPe 2.05: Domain d1s6ua_: 1s6u A:

Lineage for d1s6ua_ (1s6u A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Menkes copper-transporting ATPase [55012] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries)

8. Domain d1s6ua_: 1s6u A: [98608]
   2nd metal-binding domain
   complexed with cu1

Details for d1s6ua_

PDB Entry: 1s6u

PDB Description: solution structure and backbone dynamics of the cu(i) form of the second metal-binding domain of the menkes protein atp7a

PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1s6ua_:

Sequence; same for both SEQRES and ATOM records:

>d1s6ua_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]}
gevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisveemkkq
ieamgfpafvkkiegr

Timeline for d1s6ua_:

• d1s6ua_ first appeared in SCOP 1.67
  
• d1s6ua_ appears in SCOPe 2.04
  
• d1s6ua_ is called d1s6ua1 in SCOPe 2.06
  
• d1s6ua_ appears in the current release, SCOPe 2.08, called d1s6ua1