Lineage for d1s6qb_ (1s6q B:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884437Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 884438Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 884439Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (111 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582
    Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584
    Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 884609Domain d1s6qb_: 1s6q B: [98603]
    Other proteins in same PDB: d1s6qa1
    complexed with tpb; mutant

Details for d1s6qb_

PDB Entry: 1s6q (more details), 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r147681
PDB Compounds: (B:) POL polyprotein [Contains: Reverse transcriptase]

SCOP Domain Sequences for d1s6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6qb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

SCOP Domain Coordinates for d1s6qb_:

Click to download the PDB-style file with coordinates for d1s6qb_.
(The format of our PDB-style files is described here.)

Timeline for d1s6qb_: