SCOP 1.67: Domain d1s6qb_: 1s6q B:

Lineage for d1s6qb_ (1s6q B:)

1. Root: SCOP 1.67

2. Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (71 PDB entries)

8. Domain d1s6qb_: 1s6q B: [98603]
   Other proteins in same PDB: d1s6qa1
   complexed with tpb; mutant

Details for d1s6qb_

PDB Entry: 1s6q, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r147681

SCOP Domain Sequences for d1s6qb_:

Sequence; same for both SEQRES and ATOM records:

>d1s6qb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

Timeline for d1s6qb_:

• d1s6qb_ is new in SCOP 1.67
  
• d1s6qb_ appears in SCOP 1.69
  
• d1s6qb_ appears in the current release, SCOPe 2.08