SCOP 1.67: Domain d1s6ca_: 1s6c A:

Lineage for d1s6ca_ (1s6c A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (21 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101185] (1 PDB entry)

8. Domain d1s6ca_: 1s6c A: [98594]
   complexed with a kv4.2 peptide, chain B
   complexed with ca, cas

Details for d1s6ca_

PDB Entry: 1s6c, 2 Å

PDB Description: Crystal structure of the complex between KChIP1 and Kv4.2 N1-30

SCOP Domain Sequences for d1s6ca_:

Sequence, based on SEQRES records:

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus)}
leqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfnaf
dttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydmm
gkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm

Sequence, based on observed residues (ATOM records):

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus)}
leqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfnaf
dttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydmm
gprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm

Timeline for d1s6ca_:

• d1s6ca_ is new in SCOP 1.67
  
• d1s6ca_ appears in SCOP 1.69
  
• d1s6ca_ appears in the current release, SCOPe 2.08