Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101185] (1 PDB entry) |
Domain d1s6ca_: 1s6c A: [98594] complexed with a kv4.2 peptide, chain B complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1s6c (more details), 2 Å
SCOPe Domain Sequences for d1s6ca_:
Sequence, based on SEQRES records: (download)
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} leqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfnaf dttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydmm gkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} leqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfnaf dttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydmm gprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm
Timeline for d1s6ca_: