Lineage for d1s6ca_ (1s6c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711035Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (2 species)
  7. 2711038Species Norway rat (Rattus norvegicus) [TaxId:10116] [101185] (1 PDB entry)
  8. 2711039Domain d1s6ca_: 1s6c A: [98594]
    complexed with a kv4.2 peptide, chain B
    complexed with ca

    has additional insertions and/or extensions that are not grouped together

Details for d1s6ca_

PDB Entry: 1s6c (more details), 2 Å

PDB Description: Crystal structure of the complex between KChIP1 and Kv4.2 N1-30
PDB Compounds: (A:) Kv4 potassium channel-interacting protein KChIP1b

SCOPe Domain Sequences for d1s6ca_:

Sequence, based on SEQRES records: (download)

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
leqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfnaf
dttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydmm
gkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm

Sequence, based on observed residues (ATOM records): (download)

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
leqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfnaf
dttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydmm
gprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm

SCOPe Domain Coordinates for d1s6ca_:

Click to download the PDB-style file with coordinates for d1s6ca_.
(The format of our PDB-style files is described here.)

Timeline for d1s6ca_: