Lineage for d1s6ba_ (1s6b A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2338958Protein Snake phospholipase A2 [48624] (38 species)
  7. 2338964Species Andaman cobra (Naja sagittifera), isoform 2 [TaxId:195058] [89169] (4 PDB entries)
    heterodimer of two different isoforms
  8. 2338965Domain d1s6ba_: 1s6b A: [98592]
    heterodimer of two different isoforms
    complexed with acy, ca, po4

Details for d1s6ba_

PDB Entry: 1s6b (more details), 1.6 Å

PDB Description: x-ray crystal structure of a complex formed between two homologous isoforms of phospholipase a2 from naja naja sagittifera: principle of molecular association and inactivation
PDB Compounds: (A:) Phospholipase A2 isoform 1

SCOPe Domain Sequences for d1s6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6ba_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 2 [TaxId: 195058]}
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq

SCOPe Domain Coordinates for d1s6ba_:

Click to download the PDB-style file with coordinates for d1s6ba_.
(The format of our PDB-style files is described here.)

Timeline for d1s6ba_: