SCOP 1.67: Domain d1s68a_: 1s68 A:

Lineage for d1s68a_ (1s68 A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families)
   has a circularly permuted topology

5. Family d.142.2.4: RNA ligase 2, N-terminal domain [103286] (1 protein)

6. Protein RNA ligase 2, N-terminal domain [103287] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [103288] (1 PDB entry)

8. Domain d1s68a_: 1s68 A: [98591]
   complexed with amp

Details for d1s68a_

PDB Entry: 1s68, 1.9 Å

PDB Description: Structure and Mechanism of RNA Ligase

SCOP Domain Sequences for d1s68a_:

Sequence; same for both SEQRES and ATOM records:

>d1s68a_ d.142.2.4 (A:) RNA ligase 2, N-terminal domain {Bacteriophage T4}
mfkkysslenhynskfieklyslgltggewvarekihgtnfsliierdkvtcakrtgpil
paedffgyeiilknyadsikavqdimetsavvsyqvfgefagpgiqknvdycdkdfyvfd
iivttesgdvtyvddymmesfcntfkfkmapllgrgkfeeliklpndldsvvqdynftvd
haglvdankcvwnaeakgevftaegyvlkpcypswlrngnrvaikcknskfse

Timeline for d1s68a_:

• d1s68a_ is new in SCOP 1.67
  
• d1s68a_ appears in SCOP 1.69
  
• d1s68a_ appears in the current release, SCOPe 2.08