Lineage for d1s68a_ (1s68 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979366Family d.142.2.4: RNA ligase [103286] (2 proteins)
  6. 2979370Protein RNA ligase 2, N-terminal domain [103287] (1 species)
  7. 2979371Species Bacteriophage T4 [TaxId:10665] [103288] (1 PDB entry)
  8. 2979372Domain d1s68a_: 1s68 A: [98591]
    complexed with amp

Details for d1s68a_

PDB Entry: 1s68 (more details), 1.9 Å

PDB Description: Structure and Mechanism of RNA Ligase
PDB Compounds: (A:) RNA Ligase 2

SCOPe Domain Sequences for d1s68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s68a_ d.142.2.4 (A:) RNA ligase 2, N-terminal domain {Bacteriophage T4 [TaxId: 10665]}
mfkkysslenhynskfieklyslgltggewvarekihgtnfsliierdkvtcakrtgpil
paedffgyeiilknyadsikavqdimetsavvsyqvfgefagpgiqknvdycdkdfyvfd
iivttesgdvtyvddymmesfcntfkfkmapllgrgkfeeliklpndldsvvqdynftvd
haglvdankcvwnaeakgevftaegyvlkpcypswlrngnrvaikcknskfse

SCOPe Domain Coordinates for d1s68a_:

Click to download the PDB-style file with coordinates for d1s68a_.
(The format of our PDB-style files is described here.)

Timeline for d1s68a_: