![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.4: RNA ligase [103286] (2 proteins) |
![]() | Protein RNA ligase 2, N-terminal domain [103287] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [103288] (1 PDB entry) |
![]() | Domain d1s68a_: 1s68 A: [98591] complexed with amp |
PDB Entry: 1s68 (more details), 1.9 Å
SCOPe Domain Sequences for d1s68a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s68a_ d.142.2.4 (A:) RNA ligase 2, N-terminal domain {Bacteriophage T4 [TaxId: 10665]} mfkkysslenhynskfieklyslgltggewvarekihgtnfsliierdkvtcakrtgpil paedffgyeiilknyadsikavqdimetsavvsyqvfgefagpgiqknvdycdkdfyvfd iivttesgdvtyvddymmesfcntfkfkmapllgrgkfeeliklpndldsvvqdynftvd haglvdankcvwnaeakgevftaegyvlkpcypswlrngnrvaikcknskfse
Timeline for d1s68a_: