Lineage for d1s5xb_ (1s5x B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759065Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (7 PDB entries)
  8. 759071Domain d1s5xb_: 1s5x B: [98586]
    Other proteins in same PDB: d1s5xa_
    complexed with ace, hem

Details for d1s5xb_

PDB Entry: 1s5x (more details), 2.4 Å

PDB Description: The crystal structure of Trematomus bernacchii hemoglobin oxidized by air
PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1s5xb_:

Sequence, based on SEQRES records: (download)

>d1s5xb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkq

Sequence, based on observed residues (ATOM records): (download)

>d1s5xb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgaiignanvaahgikvl
hgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqg
afqkflavvvsalgkq

SCOP Domain Coordinates for d1s5xb_:

Click to download the PDB-style file with coordinates for d1s5xb_.
(The format of our PDB-style files is described here.)

Timeline for d1s5xb_: