SCOP 1.69: Domain d1s5xa_: 1s5x A:

Lineage for d1s5xa_ (1s5x A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (18 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (4 PDB entries)

8. Domain d1s5xa_: 1s5x A: [98585]
   Other proteins in same PDB: d1s5xb_

Details for d1s5xa_

PDB Entry: 1s5x, 2.4 Å

PDB Description: The crystal structure of Trematomus bernacchii hemoglobin oxidized by air

SCOP Domain Sequences for d1s5xa_:

Sequence; same for both SEQRES and ATOM records:

>d1s5xa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1s5xa_:

• d1s5xa_ first appeared in SCOP 1.67
  
• d1s5xa_ appears in SCOP 1.71
  
• d1s5xa_ appears in the current release, SCOPe 2.08