SCOPe 2.01: Domain d1s5uf_: 1s5u F:

Lineage for d1s5uf_ (1s5u F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical protein YbgC [102901] (1 species)

7. Species Escherichia coli [TaxId:562] [102902] (1 PDB entry)

8. Domain d1s5uf_: 1s5u F: [98578]
   structural genomics
   complexed with edo, so4

Details for d1s5uf_

PDB Entry: 1s5u, 1.7 Å

PDB Description: Crystal Structure of Hypothetical Protein EC709 from Escherichia coli

PDB Compounds: (F:) Protein ybgC

SCOPe Domain Sequences for d1s5uf_:

Sequence; same for both SEQRES and ATOM records:

>d1s5uf_ d.38.1.1 (F:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}
tlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmt
veyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpra
lpksivaefk

Timeline for d1s5uf_:

• d1s5uf_ first appeared in SCOP 1.67
  
• d1s5uf_ appears in SCOP 1.75
  
• d1s5uf_ appears in SCOPe 2.02
  
• d1s5uf_ appears in the current release, SCOPe 2.08