SCOPe 2.07: Domain d1s5tb_: 1s5t B:

Lineage for d1s5tb_ (1s5t B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (13 species)

7. Species Escherichia coli [TaxId:562] [51575] (17 PDB entries)

8. Domain d1s5tb_: 1s5t B: [98572]
   mutant

Details for d1s5tb_

PDB Entry: 1s5t, 2.3 Å

PDB Description: crystal structure analysis of a mutant of dihydrodipicolinate synthase--residue thr44 to val44

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1s5tb_:

Sequence; same for both SEQRES and ATOM records:

>d1s5tb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgvtgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

Timeline for d1s5tb_:

• d1s5tb_ first appeared in SCOP 1.67
  
• d1s5tb_ appears in SCOPe 2.06
  
• d1s5tb_ appears in the current release, SCOPe 2.08