SCOP 1.67: Domain d1s5ta_: 1s5t A:

Lineage for d1s5ta_ (1s5t A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (5 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (10 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (2 species)

7. Species Escherichia coli [TaxId:562] [51575] (4 PDB entries)

8. Domain d1s5ta_: 1s5t A: [98571]

Details for d1s5ta_

PDB Entry: 1s5t, 2.3 Å

PDB Description: crystal structure analysis of a mutant of dihydrodipicolinate synthase--residue thr44 to val44

SCOP Domain Sequences for d1s5ta_:

Sequence; same for both SEQRES and ATOM records:

>d1s5ta_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Escherichia coli}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgvtgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

Timeline for d1s5ta_:

• d1s5ta_ is new in SCOP 1.67
  
• d1s5ta_ appears in SCOP 1.69
  
• d1s5ta_ appears in the current release, SCOPe 2.08