Lineage for d1s5pa_ (1s5p A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694413Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (7 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 694446Protein NAD-dependent deacetylase CobB [102292] (1 species)
  7. 694447Species Escherichia coli [TaxId:562] [102293] (1 PDB entry)
  8. 694448Domain d1s5pa_: 1s5p A: [98569]
    complex with a acetylated substrate peptide, chain B
    complexed with zn

Details for d1s5pa_

PDB Entry: 1s5p (more details), 1.96 Å

PDB Description: Structure and substrate binding properties of cobB, a Sir2 homolog protein deacetylase from Eschericia coli.
PDB Compounds: (A:) NAD-dependent deacetylase

SCOP Domain Sequences for d1s5pa_:

Sequence, based on SEQRES records: (download)

>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]}
kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
qvldwtgdvtpedkchccqfpaplrphvvwfgemplgmdeiymalsmadifiaigtsghv
ypaagfvheaklhgahtvelnlepsqvgnefaekyygpasqvvpefvekllkglk

Sequence, based on observed residues (ATOM records): (download)

>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]}
kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
qvldwtgdvtpedkcplrphvvwfgemplgmdeiymalsmadifiaigtsghvypaagfv
heaklhgahtvelnlepsqefaekyygpasqvvpefvekllkglk

SCOP Domain Coordinates for d1s5pa_:

Click to download the PDB-style file with coordinates for d1s5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1s5pa_: