Lineage for d1s5en_ (1s5e N:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1313714Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1313715Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1313780Domain d1s5en_: 1s5e N: [98558]
    Other proteins in same PDB: d1s5ea_, d1s5eb_
    complexed with gal, na

Details for d1s5en_

PDB Entry: 1s5e (more details), 1.9 Å

PDB Description: cholera holotoxin, crystal form 1
PDB Compounds: (N:) cholera toxin B protein (CTB)

SCOPe Domain Sequences for d1s5en_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5en_ b.40.2.1 (N:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1s5en_:

Click to download the PDB-style file with coordinates for d1s5en_.
(The format of our PDB-style files is described here.)

Timeline for d1s5en_: