Lineage for d1s5ej_ (1s5e J:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667368Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 667369Species Vibrio cholerae [TaxId:666] [50209] (23 PDB entries)
  8. 667430Domain d1s5ej_: 1s5e J: [98554]
    Other proteins in same PDB: d1s5ea_, d1s5eb_

Details for d1s5ej_

PDB Entry: 1s5e (more details), 1.9 Å

PDB Description: cholera holotoxin, crystal form 1
PDB Compounds: (J:) cholera toxin B protein (CTB)

SCOP Domain Sequences for d1s5ej_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ej_ b.40.2.1 (J:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1s5ej_:

Click to download the PDB-style file with coordinates for d1s5ej_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ej_: