Lineage for d1s5eb_ (1s5e B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514038Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 514039Superfamily d.166.1: ADP-ribosylation [56399] (4 families) (S)
  5. 514040Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)
  6. 514056Protein Cholera toxin [56410] (1 species)
  7. 514057Species Vibrio cholerae [TaxId:666] [56411] (6 PDB entries)
  8. 514060Domain d1s5eb_: 1s5e B: [98548]
    Other proteins in same PDB: d1s5ed_, d1s5ee_, d1s5ef_, d1s5eg_, d1s5eh_, d1s5ej_, d1s5ek_, d1s5el_, d1s5em_, d1s5en_

Details for d1s5eb_

PDB Entry: 1s5e (more details), 1.9 Å

PDB Description: Cholera holotoxin, Crystal form 1

SCOP Domain Sequences for d1s5eb_:

Sequence, based on SEQRES records: (download)

>d1s5eb_ d.166.1.1 (B:) Cholera toxin {Vibrio cholerae}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnr

Sequence, based on observed residues (ATOM records): (download)

>d1s5eb_ d.166.1.1 (B:) Cholera toxin {Vibrio cholerae}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgcgntcdektqslgvkfldeyqskvkrqifsgyqsdidthnr

SCOP Domain Coordinates for d1s5eb_:

Click to download the PDB-style file with coordinates for d1s5eb_.
(The format of our PDB-style files is described here.)

Timeline for d1s5eb_: