Class b: All beta proteins [48724] (141 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Cholera toxin [50208] (1 species) barrel, partly opened; n*=5, S*=10 |
Species Vibrio cholerae [TaxId:666] [50209] (19 PDB entries) |
Domain d1s5dh_: 1s5d H: [98546] Other proteins in same PDB: d1s5da_ complexed with gal, gol, na; mutant |
PDB Entry: 1s5d (more details), 1.75 Å
SCOP Domain Sequences for d1s5dh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5dh_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae} tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d1s5dh_: