SCOP 1.69: Domain d1s5dg_: 1s5d G:

Lineage for d1s5dg_ (1s5d G:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (19 PDB entries)

8. Domain d1s5dg_: 1s5d G: [98545]
   Other proteins in same PDB: d1s5da_

Details for d1s5dg_

PDB Entry: 1s5d, 1.75 Å

PDB Description: cholera holotoxin with an a-subunit y30s mutation, crystal form 2

SCOP Domain Sequences for d1s5dg_:

Sequence; same for both SEQRES and ATOM records:

>d1s5dg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1s5dg_:

• d1s5dg_ first appeared in SCOP 1.67
  
• d1s5dg_ appears in SCOP 1.71
  
• d1s5dg_ appears in the current release, SCOPe 2.08