SCOP 1.75: Domain d1s5cd_: 1s5c D:

Lineage for d1s5cd_ (1s5c D:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
   Uniprot P01556 22-124

8. Domain d1s5cd_: 1s5c D: [98536]
   Other proteins in same PDB: d1s5ca_

Details for d1s5cd_

PDB Entry: 1s5c, 2.5 Å

PDB Description: cholera holotoxin with an a-subunit y30s mutation, crystal form 1

PDB Compounds: (D:) cholera enterotoxin B-subunit

SCOP Domain Sequences for d1s5cd_:

Sequence; same for both SEQRES and ATOM records:

>d1s5cd_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1s5cd_:

• d1s5cd_ first appeared in SCOP 1.67
  
• d1s5cd_ appears in SCOP 1.73
  
• d1s5cd_ appears in SCOPe 2.01
  
• d1s5cd_ appears in the current release, SCOPe 2.08