Lineage for d1s5bd_ (1s5b D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 373968Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 373969Species Vibrio cholerae [TaxId:666] [50209] (19 PDB entries)
  8. 374035Domain d1s5bd_: 1s5b D: [98530]
    Other proteins in same PDB: d1s5ba_

Details for d1s5bd_

PDB Entry: 1s5b (more details), 2.13 Å

PDB Description: Cholera holotoxin with an A-subunit Y30S mutation Form 3

SCOP Domain Sequences for d1s5bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5bd_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1s5bd_:

Click to download the PDB-style file with coordinates for d1s5bd_.
(The format of our PDB-style files is described here.)

Timeline for d1s5bd_: