Lineage for d1s5ba_ (1s5b A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208076Family d.166.1.1: ADP-ribosylating toxins [56400] (10 protein domains)
  6. 2208095Protein Cholera toxin [56410] (1 species)
  7. 2208096Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries)
  8. 2208102Domain d1s5ba_: 1s5b A: [98529]
    Other proteins in same PDB: d1s5bd_, d1s5be_, d1s5bf_, d1s5bg_, d1s5bh_
    complexed with na; mutant

Details for d1s5ba_

PDB Entry: 1s5b (more details), 2.13 Å

PDB Description: Cholera holotoxin with an A-subunit Y30S mutation Form 3
PDB Compounds: (A:) Cholera enterotoxin, A chain precursor

SCOPe Domain Sequences for d1s5ba_:

Sequence, based on SEQRES records: (download)

>d1s5ba_ d.166.1.1 (A:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprgqsesfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpdeqevsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgcgnaprssmsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnr

Sequence, based on observed residues (ATOM records): (download)

>d1s5ba_ d.166.1.1 (A:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprmninlydharvrhddgyvstsislrsahlvgqtil
sghstyyiyviatapnmfnvndvlgaysphpdeqevsalggipysqiygwyrvhfgvldq
lhrnrgyrdryysnldiapaadgyglagfppehrawreepwihhappgcgtcdektqslg
vkfldeyqskvkrqifsgyqsdidthnr

SCOPe Domain Coordinates for d1s5ba_:

Click to download the PDB-style file with coordinates for d1s5ba_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ba_: