![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) |
![]() | Protein Hypothetical protein YesE [102814] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry) |
![]() | Domain d1s5ad_: 1s5a D: [98528] structural genomics complexed with act, gol |
PDB Entry: 1s5a (more details), 1.7 Å
SCOPe Domain Sequences for d1s5ad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5ad_ d.17.4.10 (D:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg rivryrdywnplvvkeafg
Timeline for d1s5ad_: