Lineage for d1s5ad_ (1s5a D:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855976Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 855977Protein Hypothetical protein YesE [102814] (1 species)
  7. 855978Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)
  8. 855982Domain d1s5ad_: 1s5a D: [98528]
    structural genomics
    complexed with act, gol

Details for d1s5ad_

PDB Entry: 1s5a (more details), 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis
PDB Compounds: (D:) Hypothetical protein yesE

SCOP Domain Sequences for d1s5ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ad_ d.17.4.10 (D:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}
snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
rivryrdywnplvvkeafg

SCOP Domain Coordinates for d1s5ad_:

Click to download the PDB-style file with coordinates for d1s5ad_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ad_: