SCOP 1.67: Domain d1s5ad_: 1s5a D:

Lineage for d1s5ad_ (1s5a D:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (10 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.10: Hypothetical protein YesE [102813] (1 protein)

6. Protein Hypothetical protein YesE [102814] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)

8. Domain d1s5ad_: 1s5a D: [98528]
   structural genomics
   complexed with act, gol

Details for d1s5ad_

PDB Entry: 1s5a, 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis

SCOP Domain Sequences for d1s5ad_:

Sequence; same for both SEQRES and ATOM records:

>d1s5ad_ d.17.4.10 (D:) Hypothetical protein YesE {Bacillus subtilis}
snamlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaai
ydyikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdg
rivryrdywnplvvkeafg

Timeline for d1s5ad_:

• d1s5ad_ is new in SCOP 1.67
  
• d1s5ad_ appears in SCOP 1.69
  
• d1s5ad_ appears in the current release, SCOPe 2.08, called d1s5ad1