Lineage for d1s5ad1 (1s5a D:1-136)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936970Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 2936971Protein Hypothetical protein YesE [102814] (1 species)
  7. 2936972Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)
  8. 2936976Domain d1s5ad1: 1s5a D:1-136 [98528]
    Other proteins in same PDB: d1s5ab2, d1s5ac2, d1s5ad2
    structural genomics
    complexed with act, gol

Details for d1s5ad1

PDB Entry: 1s5a (more details), 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis
PDB Compounds: (D:) Hypothetical protein yesE

SCOPe Domain Sequences for d1s5ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ad1 d.17.4.10 (D:1-136) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}
mlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiydy
ikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgriv
ryrdywnplvvkeafg

SCOPe Domain Coordinates for d1s5ad1:

Click to download the PDB-style file with coordinates for d1s5ad1.
(The format of our PDB-style files is described here.)

Timeline for d1s5ad1: