Lineage for d1s5ac1 (1s5a C:1-142)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544048Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 2544049Protein Hypothetical protein YesE [102814] (1 species)
  7. 2544050Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)
  8. 2544053Domain d1s5ac1: 1s5a C:1-142 [98527]
    Other proteins in same PDB: d1s5ab2, d1s5ac2, d1s5ad2
    structural genomics
    complexed with act, gol

Details for d1s5ac1

PDB Entry: 1s5a (more details), 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis
PDB Compounds: (C:) Hypothetical protein yesE

SCOPe Domain Sequences for d1s5ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ac1 d.17.4.10 (C:1-142) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}
mlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiydy
ikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgriv
ryrdywnplvvkeafggsflqt

SCOPe Domain Coordinates for d1s5ac1:

Click to download the PDB-style file with coordinates for d1s5ac1.
(The format of our PDB-style files is described here.)

Timeline for d1s5ac1: