Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) |
Protein Hypothetical protein YesE [102814] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry) |
Domain d1s5ac1: 1s5a C:1-142 [98527] Other proteins in same PDB: d1s5ab2, d1s5ac2, d1s5ad2 structural genomics complexed with act, gol |
PDB Entry: 1s5a (more details), 1.7 Å
SCOPe Domain Sequences for d1s5ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5ac1 d.17.4.10 (C:1-142) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} mlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiydy ikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgriv ryrdywnplvvkeafggsflqt
Timeline for d1s5ac1: