SCOPe 2.01: Domain d1s5ac_: 1s5a C:

Lineage for d1s5ac_ (1s5a C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)

6. Protein Hypothetical protein YesE [102814] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)

8. Domain d1s5ac_: 1s5a C: [98527]
   structural genomics
   complexed with act, gol

Details for d1s5ac_

PDB Entry: 1s5a, 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis

PDB Compounds: (C:) Hypothetical protein yesE

SCOPe Domain Sequences for d1s5ac_:

Sequence; same for both SEQRES and ATOM records:

>d1s5ac_ d.17.4.10 (C:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}
amlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiyd
yikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgri
vryrdywnplvvkeafggsflqt

Timeline for d1s5ac_:

• d1s5ac_ first appeared in SCOP 1.67
  
• d1s5ac_ appears in SCOP 1.75
  
• d1s5ac_ appears in SCOPe 2.02
  
• d1s5ac_ appears in the current release, SCOPe 2.08, called d1s5ac1