Lineage for d1s5ac_ (1s5a C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020475Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 1020476Protein Hypothetical protein YesE [102814] (1 species)
  7. 1020477Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)
  8. 1020480Domain d1s5ac_: 1s5a C: [98527]
    structural genomics
    complexed with act, gol

Details for d1s5ac_

PDB Entry: 1s5a (more details), 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis
PDB Compounds: (C:) Hypothetical protein yesE

SCOPe Domain Sequences for d1s5ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ac_ d.17.4.10 (C:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}
amlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiyd
yikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgri
vryrdywnplvvkeafggsflqt

SCOPe Domain Coordinates for d1s5ac_:

Click to download the PDB-style file with coordinates for d1s5ac_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ac_: