![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (30 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) |
![]() | Protein Hypothetical protein YesE [102814] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry) |
![]() | Domain d1s5ac_: 1s5a C: [98527] structural genomics |
PDB Entry: 1s5a (more details), 1.7 Å
SCOP Domain Sequences for d1s5ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5ac_ d.17.4.10 (C:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} amlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiyd yikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgri vryrdywnplvvkeafggsflqt
Timeline for d1s5ac_: