SCOPe 2.08: Domain d1s5ac1: 1s5a C:1-142

Lineage for d1s5ac1 (1s5a C:1-142)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.4: NTF2-like [54427] (31 families)
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
Protein Hypothetical protein YesE [102814] (1 species)
Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)
Domain d1s5ac1: 1s5a C:1-142 [98527]
Other proteins in same PDB: d1s5ab2, d1s5ac2, d1s5ad2
structural genomics
complexed with act, gol

Details for d1s5ac1

PDB Entry: 1s5a (more details), 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis

PDB Compounds: (C:) Hypothetical protein yesE

SCOPe Domain Sequences for d1s5ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ac1 d.17.4.10 (C:1-142) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}
mlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiydy
ikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgriv
ryrdywnplvvkeafggsflqt

SCOPe Domain Coordinates for d1s5ac1:

Click to download the PDB-style file with coordinates for d1s5ac1.
(The format of our PDB-style files is described here.)

Timeline for d1s5ac1: