SCOPe 2.08: Domain d1s4vb_: 1s4v B:

Lineage for d1s4vb_ (1s4v B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Vignain (bean endopeptidase) [102719] (1 species)

7. Species Castor bean (Ricinus communis) [TaxId:3988] [102720] (1 PDB entry)

8. Domain d1s4vb_: 1s4v B: [98512]
   complexed with so4

Details for d1s4vb_

PDB Entry: 1s4v, 2 Å

PDB Description: The 2.0 A crystal structure of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm

PDB Compounds: (B:) cysteine endopeptidase

SCOPe Domain Sequences for d1s4vb_:

Sequence; same for both SEQRES and ATOM records:

>d1s4vb_ d.3.1.1 (B:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]}
tvpasvdwrkkgavtsvkdqgqcgscwafstivaveginqiktnklvslseqelvdcdtd
qnqgcngglmdyafefikqrggitteanypyeaydgtcdvskenapavsidghenvpend
enallkavanqpvsvaidaggsdfqfysegvftgscgteldhgvaivgygttidgtkywt
vknswgpewgekgyirmergisdkeglcgiameasypikkssnnps

Timeline for d1s4vb_:

• d1s4vb_ first appeared in SCOP 1.67
  
• d1s4vb_ appears in SCOPe 2.07