SCOP 1.67: Domain d1s4ra_: 1s4r A:

Lineage for d1s4ra_ (1s4r A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (24 PDB entries)

8. Domain d1s4ra_: 1s4r A: [98508]
   complexed with hc4

Details for d1s4ra_

PDB Entry: 1s4r, 1.9 Å

PDB Description: structure of a reaction intermediate in the photocycle of pyp extracted by a svd-driven analysis

SCOP Domain Sequences for d1s4ra_:

Sequence; same for both SEQRES and ATOM records:

>d1s4ra_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d1s4ra_:

• d1s4ra_ is new in SCOP 1.67
  
• d1s4ra_ appears in SCOP 1.69
  
• d1s4ra_ appears in the current release, SCOPe 2.08