Lineage for d1s4pa_ (1s4p A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400342Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 400343Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 400662Family c.68.1.16: Glycolipid 2-alpha-mannosyltransferase [102609] (1 protein)
  6. 400663Protein Glycolipid 2-alpha-mannosyltransferase [102610] (1 species)
  7. 400664Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102611] (3 PDB entries)
  8. 400667Domain d1s4pa_: 1s4p A: [98505]

Details for d1s4pa_

PDB Entry: 1s4p (more details), 2.01 Å

PDB Description: crystal structure of yeast alpha1,2-mannosyltransferase kre2p/mnt1p: ternary complex with gdp/mn and methyl-alpha-mannoside acceptor

SCOP Domain Sequences for d1s4pa_:

Sequence, based on SEQRES records: (download)

>d1s4pa_ c.68.1.16 (A:) Glycolipid 2-alpha-mannosyltransferase {Baker's yeast (Saccharomyces cerevisiae)}
kttmdyitpsfankagkpkacyvtlvrnkelkgllssikyvenkinkkfpypwvflndep
fteefkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiyggsesyrhm
cryqsgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygftvsiheyevt
iptlwqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianlnlwrspayre
yfdtldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydncpldkevyns
nncecdqgndftfqgyscgkeyydaqglvkpknwkkfre

Sequence, based on observed residues (ATOM records): (download)

>d1s4pa_ c.68.1.16 (A:) Glycolipid 2-alpha-mannosyltransferase {Baker's yeast (Saccharomyces cerevisiae)}
kttmdyitpsfgkpkacyvtlvrnkelkgllssikyvenkinkkfpypwvflndepftee
fkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiyggsesyrhmcryq
sgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygftvsiheyevtiptl
wqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianlnlwrspayreyfdt
ldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydncpldkevynsnnce
cdqgndftfqgyscgkeyydaqglvkpknwkkfre

SCOP Domain Coordinates for d1s4pa_:

Click to download the PDB-style file with coordinates for d1s4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1s4pa_: