Lineage for d1s4nb_ (1s4n B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133856Family c.68.1.16: Glycolipid 2-alpha-mannosyltransferase [102609] (1 protein)
    automatically mapped to Pfam PF01793
  6. 2133857Protein Glycolipid 2-alpha-mannosyltransferase [102610] (1 species)
  7. 2133858Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102611] (3 PDB entries)
  8. 2133860Domain d1s4nb_: 1s4n B: [98502]
    complexed with cl, gol

Details for d1s4nb_

PDB Entry: 1s4n (more details), 2.01 Å

PDB Description: Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p
PDB Compounds: (B:) Glycolipid 2-alpha-mannosyltransferase

SCOPe Domain Sequences for d1s4nb_:

Sequence, based on SEQRES records: (download)

>d1s4nb_ c.68.1.16 (B:) Glycolipid 2-alpha-mannosyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkttmdyitpsfankagkpkacyvtlvrnkelkgllssikyvenkinkkfpypwvflnde
pfteefkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiyggsesyrh
mcryqsgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygftvsiheyev
tiptlwqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianlnlwrspayr
eyfdtldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydncpldkevyn
snncecdqgndftfqgyscgkeyydaqglvkpknwkkfre

Sequence, based on observed residues (ATOM records): (download)

>d1s4nb_ c.68.1.16 (B:) Glycolipid 2-alpha-mannosyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkttmdyitpsfkpkacyvtlvrnkelkgllssikyvenkinkkfpypwvflndepftee
fkeavtkavssevkfgilpkehwsypewinqtkaaeiradaatkyiyggsesyrhmcryq
sgffwrhelleeydwywrvepdiklycdinydvfkwmqenekvygftvsiheyevtiptl
wqtsmdfikknpeyldennlmsflsndngktynlchfwsnfeianlnlwrspayreyfdt
ldhqggffyerwgdapvhsiaaalflpkdkihyfsdigyhhppydncpldkevynsnnce
cdqgndftfqgyscgkeyydaqglvkpknwkkfre

SCOPe Domain Coordinates for d1s4nb_:

Click to download the PDB-style file with coordinates for d1s4nb_.
(The format of our PDB-style files is described here.)

Timeline for d1s4nb_: