Lineage for d1s4fd_ (1s4f D:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424729Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 424737Protein Viral RNA polymerase [56695] (5 species)
  7. 424738Species Bovine viral diarrhea virus [TaxId:11099] [103401] (3 PDB entries)
  8. 424744Domain d1s4fd_: 1s4f D: [98498]

Details for d1s4fd_

PDB Entry: 1s4f (more details), 3 Å

PDB Description: Crystal Structure of RNA-dependent RNA polymerase construct 2 from bovine viral diarrhea virus (BVDV)

SCOP Domain Sequences for d1s4fd_:

Sequence, based on SEQRES records: (download)

>d1s4fd_ e.8.1.4 (D:) Viral RNA polymerase {Bovine viral diarrhea virus}
virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
shmagrdtavilskmatrldssgergttayekavafsfllmyswnplvrricllvlsqqp
etdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskri
iqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhye

Sequence, based on observed residues (ATOM records): (download)

>d1s4fd_ e.8.1.4 (D:) Viral RNA polymerase {Bovine viral diarrhea virus}
virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
dwqagrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrkewdsfn
epvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvitadgevy
irngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgflitekg
lglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdntsshmagr
dtavilskmatrsgergttayekavafsfllmyswnplvrricllvlsqqpetdpskhat
yyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskriiqdcvaigk
eegnwlvkpdrlissktghlyipdkgftlqgkhye

SCOP Domain Coordinates for d1s4fd_:

Click to download the PDB-style file with coordinates for d1s4fd_.
(The format of our PDB-style files is described here.)

Timeline for d1s4fd_: