Lineage for d1s4fb_ (1s4f B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017426Protein Viral RNA polymerase [56695] (17 species)
  7. 3017429Species Bovine viral diarrhea virus [TaxId:11099] [103401] (3 PDB entries)
  8. 3017433Domain d1s4fb_: 1s4f B: [98496]

Details for d1s4fb_

PDB Entry: 1s4f (more details), 3 Å

PDB Description: Crystal Structure of RNA-dependent RNA polymerase construct 2 from bovine viral diarrhea virus (BVDV)
PDB Compounds: (B:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d1s4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4fb_ e.8.1.4 (B:) Viral RNA polymerase {Bovine viral diarrhea virus [TaxId: 11099]}
virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
shmagrdtavilskmatrldssgergttayekavafsfllmyswnplvrricllvlsqqp
etdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskri
iqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhy

SCOPe Domain Coordinates for d1s4fb_:

Click to download the PDB-style file with coordinates for d1s4fb_.
(The format of our PDB-style files is described here.)

Timeline for d1s4fb_: