![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.26.7: Galactokinase [103011] (1 protein) |
![]() | Protein Galactokinase [103012] (3 species) |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [103014] (1 PDB entry) |
![]() | Domain d1s4eg2: 1s4e G:184-347 [98490] Other proteins in same PDB: d1s4ea1, d1s4eb1, d1s4ec1, d1s4ed1, d1s4ee1, d1s4ef1, d1s4eg1, d1s4eh1, d1s4ei1 |
PDB Entry: 1s4e (more details), 2.9 Å
SCOP Domain Sequences for d1s4eg2:
Sequence, based on SEQRES records: (download)
>d1s4eg2 d.58.26.7 (G:184-347) Galactokinase {Archaeon Pyrococcus furiosus} vlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyivr enarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygarlt gagfggsaialvdkdkaktigdailreylakfswkakyfvvkps
>d1s4eg2 d.58.26.7 (G:184-347) Galactokinase {Archaeon Pyrococcus furiosus} vlvfytgvkasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsyivrena rvlevrdalegdiekvgkilttahwdlaenyrvsceeldffvkkamelgaygarltgagf ggsaidkdaktigdailreylakfswkakfvvkps
Timeline for d1s4eg2: