SCOP 1.71: Domain d1s4ef1: 1s4e F:2-180

Lineage for d1s4ef1 (1s4e F:2-180)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)

6. Protein Galactokinase [102762] (3 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [102764] (1 PDB entry)

8. Domain d1s4ef1: 1s4e F:2-180 [98487]
   Other proteins in same PDB: d1s4ea2, d1s4eb2, d1s4ec2, d1s4ed2, d1s4ee2, d1s4ef2, d1s4eg2, d1s4eh2, d1s4ei2

Details for d1s4ef1

PDB Entry: 1s4e, 2.9 Å

PDB Description: pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium

SCOP Domain Sequences for d1s4ef1:

Sequence; same for both SEQRES and ATOM records:

>d1s4ef1 d.14.1.5 (F:2-180) Galactokinase {Archaeon Pyrococcus furiosus}
skitvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftld
nltkegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnql
ynlnidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk

Timeline for d1s4ef1:

• d1s4ef1 first appeared in SCOP 1.67
  
• d1s4ef1 appears in SCOP 1.69
  
• d1s4ef1 appears in SCOP 1.73
  
• d1s4ef1 appears in the current release, SCOPe 2.08