Lineage for d1s49a_ (1s49 A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424729Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 424737Protein Viral RNA polymerase [56695] (5 species)
  7. 424738Species Bovine viral diarrhea virus [TaxId:11099] [103401] (3 PDB entries)
  8. 424740Domain d1s49a_: 1s49 A: [98476]
    complexed with gtp

Details for d1s49a_

PDB Entry: 1s49 (more details), 3 Å

PDB Description: Crystal Structure of RNA-dependent RNA polymerase construct 1 (residues 71-679) from bovine viral diarrhea virus complexed with GTP

SCOP Domain Sequences for d1s49a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s49a_ e.8.1.4 (A:) Viral RNA polymerase {Bovine viral diarrhea virus}
virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
shmagrdtavilskmatrldssgergttayekavafsfllmyswnplvrricllvlsqqp
etdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskri
iqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhyeqlql

SCOP Domain Coordinates for d1s49a_:

Click to download the PDB-style file with coordinates for d1s49a_.
(The format of our PDB-style files is described here.)

Timeline for d1s49a_: