Lineage for d1s48a_ (1s48 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623022Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2623030Protein Viral RNA polymerase [56695] (17 species)
  7. 2623033Species Bovine viral diarrhea virus [TaxId:11099] [103401] (3 PDB entries)
  8. 2623034Domain d1s48a_: 1s48 A: [98475]

Details for d1s48a_

PDB Entry: 1s48 (more details), 3 Å

PDB Description: Crystal structure of RNA-dependent RNA polymerase construct 1 (residues 71-679) from BVDV
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d1s48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s48a_ e.8.1.4 (A:) Viral RNA polymerase {Bovine viral diarrhea virus [TaxId: 11099]}
virehnkwilkkirfqgnlntkkmlnpgklseqldregrkrniynhqigtimssagirle
klpivraqtdtktfheairdkidksenrqnpelhnklleifhtiaqptlkhtygevtweq
leagvnrkgaagflekknigevldsekhlveqlvrdlkagrkikyyetaipknekrdvsd
dwqagdlvvekrprviqypeaktrlaitkvmynwvkqqpvvipgyegktplfnifdkvrk
ewdsfnepvavsfdtkawdtqvtskdlqligeiqkyyykkewhkfidtitdhmtevpvit
adgevyirngqrgsgqpdtsagnsmlnvltmmyafcestgvpyksfnrvarihvcgddgf
litekglglkfankgmqilheagkpqkitegekmkvayrfediefcshtpvpvrwsdnts
shmagrdtavilskmatrldssgergttayekavafsfllmyswnplvrricllvlsqqp
etdpskhatyyykgdpigaykdvigrnlselkrtgfeklanlnlslstlgvwtkhtskri
iqdcvaigkeegnwlvkpdrlissktghlyipdkgftlqgkhyeqlql

SCOPe Domain Coordinates for d1s48a_:

Click to download the PDB-style file with coordinates for d1s48a_.
(The format of our PDB-style files is described here.)

Timeline for d1s48a_: