SCOP 1.75: Domain d1s3xa1: 1s3x A:3-188

Lineage for d1s3xa1 (1s3x A:3-188)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53071] (6 PDB entries)

8. Domain d1s3xa1: 1s3x A:3-188 [98467]

Details for d1s3xa1

PDB Entry: 1s3x, 1.84 Å

PDB Description: the crystal structure of the human hsp70 atpase domain

PDB Compounds: (A:) Heat shock 70 kDa protein 1

SCOP Domain Sequences for d1s3xa1:

Sequence; same for both SEQRES and ATOM records:

>d1s3xa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
kaaaigidlgttyscigvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
ygldrt

Timeline for d1s3xa1:

• d1s3xa1 first appeared in SCOP 1.67
  
• d1s3xa1 appears in SCOP 1.73
  
• d1s3xa1 appears in SCOPe 2.01
  
• d1s3xa1 appears in the current release, SCOPe 2.08