Lineage for d1s3tc2 (1s3t C:132-434,C:484-570)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385405Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 385429Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 385430Protein alpha-subunit of urease, catalytic domain [51561] (3 species)
  7. 385431Species Bacillus pasteurii [TaxId:1474] [51563] (6 PDB entries)
  8. 385437Domain d1s3tc2: 1s3t C:132-434,C:484-570 [98463]
    Other proteins in same PDB: d1s3ta_, d1s3tb_, d1s3tc1
    complexed with bo3, ni, so4

Details for d1s3tc2

PDB Entry: 1s3t (more details), 2.1 Å

PDB Description: borate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1s3tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3tc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

SCOP Domain Coordinates for d1s3tc2:

Click to download the PDB-style file with coordinates for d1s3tc2.
(The format of our PDB-style files is described here.)

Timeline for d1s3tc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s3tc1