![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) ![]() |
![]() | Family b.85.3.1: Urease, beta-subunit [51279] (1 protein) |
![]() | Protein Urease, beta-subunit [51280] (3 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [51282] (6 PDB entries) |
![]() | Domain d1s3tb_: 1s3t B: [98461] Other proteins in same PDB: d1s3ta_, d1s3tc1, d1s3tc2 |
PDB Entry: 1s3t (more details), 2.1 Å
SCOP Domain Sequences for d1s3tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3tb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii} nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg ve
Timeline for d1s3tb_: