Lineage for d1s3ta_ (1s3t A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407171Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 407172Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 407173Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 407174Protein Urease, gamma-subunit [54113] (3 species)
  7. 407175Species Bacillus pasteurii [TaxId:1474] [54115] (6 PDB entries)
  8. 407181Domain d1s3ta_: 1s3t A: [98460]
    Other proteins in same PDB: d1s3tb_, d1s3tc1, d1s3tc2
    complexed with bo3, ni, so4

Details for d1s3ta_

PDB Entry: 1s3t (more details), 2.1 Å

PDB Description: borate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1s3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ta_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOP Domain Coordinates for d1s3ta_:

Click to download the PDB-style file with coordinates for d1s3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1s3ta_: