Lineage for d1s3sh_ (1s3s H:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 407835Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 407934Family d.15.1.2: UBX domain [54250] (2 proteins)
  6. 407938Protein p47 [64221] (1 species)
  7. 407939Species Rat (Rattus norvegicus) [TaxId:10116] [64222] (3 PDB entries)
  8. 407943Domain d1s3sh_: 1s3s H: [98458]
    Other proteins in same PDB: d1s3sa1, d1s3sa2, d1s3sa3, d1s3sb1, d1s3sb2, d1s3sb3, d1s3sc1, d1s3sc2, d1s3sc3, d1s3sd1, d1s3sd2, d1s3sd3, d1s3se1, d1s3se2, d1s3se3, d1s3sf1, d1s3sf2, d1s3sf3

Details for d1s3sh_

PDB Entry: 1s3s (more details), 2.9 Å

PDB Description: Crystal structure of AAA ATPase p97/VCP ND1 in complex with p47 C

SCOP Domain Sequences for d1s3sh_:

Sequence, based on SEQRES records: (download)

>d1s3sh_ d.15.1.2 (H:) p47 {Rat (Rattus norvegicus)}
gqklgstapqvlntsspaqqaeneakasssilineaepttniqirladggrlvqkfnhsh
risdirlfivdarpamaatsfvlmttfpnkeladenqtlkeanllnavivqrlt

Sequence, based on observed residues (ATOM records): (download)

>d1s3sh_ d.15.1.2 (H:) p47 {Rat (Rattus norvegicus)}
gqklgstappaqqaeneakasssilineaepttniqirladggrlvqkfnhshrisdirl
fivdarpamaatsfvlmttfpnkeladenqtlkeanllnavivqrlt

SCOP Domain Coordinates for d1s3sh_:

Click to download the PDB-style file with coordinates for d1s3sh_.
(The format of our PDB-style files is described here.)

Timeline for d1s3sh_: