Lineage for d1s3sg_ (1s3s G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018081Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 1018088Protein p47 [64221] (1 species)
  7. 1018089Species Norway rat (Rattus norvegicus) [TaxId:10116] [64222] (3 PDB entries)
  8. 1018092Domain d1s3sg_: 1s3s G: [98457]
    Other proteins in same PDB: d1s3sa1, d1s3sa2, d1s3sa3, d1s3sb1, d1s3sb2, d1s3sb3, d1s3sc1, d1s3sc2, d1s3sc3, d1s3sd1, d1s3sd2, d1s3sd3, d1s3se1, d1s3se2, d1s3se3, d1s3sf1, d1s3sf2, d1s3sf3
    complexed with the p97/VCP ND1; chain I is mostly disordered in the crystal structure
    complexed with adp

Details for d1s3sg_

PDB Entry: 1s3s (more details), 2.9 Å

PDB Description: Crystal structure of AAA ATPase p97/VCP ND1 in complex with p47 C
PDB Compounds: (G:) p47 protein

SCOPe Domain Sequences for d1s3sg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3sg_ d.15.1.2 (G:) p47 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ftgegqklgstapqvlntsspaqqaeneakasssilineaepttniqirladggrlvqkf
nhshrisdirlfivdarpamaatsfvlmttfpnkeladenqtlkeanllnavivqrlt

SCOPe Domain Coordinates for d1s3sg_:

Click to download the PDB-style file with coordinates for d1s3sg_.
(The format of our PDB-style files is described here.)

Timeline for d1s3sg_: