| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
| Family d.15.1.2: UBX domain [54250] (6 proteins) Pfam PF00789 |
| Protein p47 [64221] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [64222] (3 PDB entries) |
| Domain d1s3sg_: 1s3s G: [98457] Other proteins in same PDB: d1s3sa1, d1s3sa2, d1s3sa3, d1s3sb1, d1s3sb2, d1s3sb3, d1s3sc1, d1s3sc2, d1s3sc3, d1s3sd1, d1s3sd2, d1s3sd3, d1s3se1, d1s3se2, d1s3se3, d1s3sf1, d1s3sf2, d1s3sf3 complexed with the p97/VCP ND1; chain I is mostly disordered in the crystal structure complexed with adp |
PDB Entry: 1s3s (more details), 2.9 Å
SCOPe Domain Sequences for d1s3sg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3sg_ d.15.1.2 (G:) p47 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ftgegqklgstapqvlntsspaqqaeneakasssilineaepttniqirladggrlvqkf
nhshrisdirlfivdarpamaatsfvlmttfpnkeladenqtlkeanllnavivqrlt
Timeline for d1s3sg_: