SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1s3sf1 (1s3s F:18-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061195Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2061340Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 protein domains)
  6. 2061341Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2061350Species Mouse (Mus musculus) [TaxId:10090] [63797] (5 PDB entries)
  8. 2061362Domain d1s3sf1: 1s3s F:18-106 [98454]
    Other proteins in same PDB: d1s3sa2, d1s3sa3, d1s3sb2, d1s3sb3, d1s3sc2, d1s3sc3, d1s3sd2, d1s3sd3, d1s3se2, d1s3se3, d1s3sf2, d1s3sf3, d1s3sg_, d1s3sh_, d1s3si_
    complexed with adp

Details for d1s3sf1

PDB Entry: 1s3s (more details), 2.9 Å

PDB Description: Crystal structure of AAA ATPase p97/VCP ND1 in complex with p47 C
PDB Compounds: (F:) Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]

SCOPe Domain Sequences for d1s3sf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3sf1 b.52.2.3 (F:18-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]}
kqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtc
sdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d1s3sf1:

Click to download the PDB-style file with coordinates for d1s3sf1.
(The format of our PDB-style files is described here.)

Timeline for d1s3sf1: