Lineage for d1s3jb_ (1s3j B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722146Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1722203Protein Putative transcriptional regulator YusO [101012] (1 species)
  7. 1722204Species Bacillus subtilis [TaxId:1423] [101013] (1 PDB entry)
  8. 1722206Domain d1s3jb_: 1s3j B: [98438]
    structural genomics

Details for d1s3jb_

PDB Entry: 1s3j (more details), 2.25 Å

PDB Description: X-ray crystal structure of YusO protein from Bacillus subtilis
PDB Compounds: (B:) YusO protein

SCOPe Domain Sequences for d1s3jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3jb_ a.4.5.28 (B:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]}
ksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerm
evkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryls
flteeemlqaahitaklaqaa

SCOPe Domain Coordinates for d1s3jb_:

Click to download the PDB-style file with coordinates for d1s3jb_.
(The format of our PDB-style files is described here.)

Timeline for d1s3jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s3ja_