![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Putative transcriptional regulator YusO [101012] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101013] (1 PDB entry) |
![]() | Domain d1s3ja_: 1s3j A: [98437] structural genomics |
PDB Entry: 1s3j (more details), 2.25 Å
SCOPe Domain Sequences for d1s3ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} sadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerme vkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimarylsf lteeemlqaahitaklaqaaetd
Timeline for d1s3ja_: